101% Original
Lowest Price
Free Shipping

Buy FOXO4-DRI Online in Australia

$500

3 products sold in last 13 hours
Selling fast! Over 7 people have in their cart
22 people are viewing this right now
  • Check Mark Estimated Delivery : Up to 4 business days
  • Check Mark Free Shipping & Returns : On all orders over $200
  • Visa Card
  • MasterCard
  • American Express
  • Discover Card
  • PayPal
  • Apple Pay
Guaranteed Safe And Secure Checkout

Buy FOXO4-DRI Online in Australia (Senolytic Research Peptide)

When you need to buy FOXO4-DRI online Australia researchers count on for cellular aging studies, our local store delivers high-grade senolytic peptides directly to your facility. Specifically, we stock premium FOXO4 D-Retro-Inverso (FOXO4-DRI) backed by verified batch reports, which guarantees exceptional chemical purity and fast domestic dispatch across all Australian states.

Product Overview & Domestic Inventory

FOXO4-DRI represents a breakthrough retro-inverso cell-penetrating peptide engineered to disrupt the interaction between the FOXO4 transcription factor and p53. Consequently, this peptide selectively triggers apoptosis in senescent cells while preserving healthy surrounding tissue in scientific models. Furthermore, our team maintains domestic stock within Australia, so you bypass international customs holds and avoid border delays.

  • Current Availability: In Stock (Dispatched within 24 hours)

  • Purity Standard: HPLC & Mass Spectrometry Verified

  • Form Factor: Lyophilized powder in sterile, sealed glass vials

  • Dispatch Point: Local Australian fulfillment facility

Express Post Rates & Delivery Schedule

When you choose to buy FOXO4-DRI online Australia wide through our secure store, our logistics team handles your package immediately. Additionally, we pack all orders inside durable, temperature-conscious mailers to maintain product stability.

Delivery Option Estimated Transit Time Cost Tracking Status
Express Post (AU Domestic) 1 – 3 Business Days Flat Rate AUD (Free on orders over $150) Full Tracking Included
Same-Day Dispatch Orders placed before 2:00 PM AEST Standard Rates Apply Full Tracking Included

Note: Deliveries to remote areas in Western Australia, Northern Territory, and Regional Queensland may require 1 to 2 additional business days.

Why Buy FOXO4-DRI Online Australia From Our Supply?

Procuring complex, long-chain peptides requires complete quality assurance and operational transparency. Therefore, we base our supply chain on three non-negotiable guarantees:

1. High-Purity HPLC Batch Testing

Our partner laboratories test every batch of FOXO4-DRI through High-Performance Liquid Chromatography (HPLC) and Mass Spectrometry (MS). As a result, we verify the complex D-amino acid sequence and ensure that overall purity exceeds 98%.

2. Zero Customs Risk or Import Seizures

Shipping retro-inverso peptides across international borders often leads to customs confiscation or heat damage from long transit windows. However, sourcing directly from an Australian warehouse guarantees smooth domestic delivery with zero border risks.

3. Discreet and Protective Packaging

Our warehouse staff seals every vial inside tamper-evident containers. Additionally, we mail your package in plain, protective envelopes to ensure your supply arrives safely.

Technical Specifications & Storage Guidelines

Parameter Specification
Sequence D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)
CAS Registry Number 2460055-10-9
Molecular Formula
Molecular Weight
Biological Target FOXO4 / p53 Interaction Inhibitor
Storage (Lyophilized) Store dry at for maximum long-term stability
Storage (Reconstituted) Refrigerate between ; protect from light

Ordering Options & Payment Policies

We simplify procurement when you buy FOXO4-DRI online Australia wide by offering flexible payment channels and volume incentives:

  • Payment Options: Visa, Mastercard, Direct Australian Bank Transfer, and Select Cryptocurrencies.

  • Tiered Bulk Discounts: Our checkout automatically applies wholesale discounts when you order 5+, 10+, or 20+ vials.

  • Delivery Guarantee: In the unlikely event that a courier damages your shipment during domestic transit, our support staff dispatches a replacement package immediately.

Frequently Asked Questions (FAQ)

How quickly will my order arrive in Sydney, Melbourne, or Brisbane?

Express post parcels heading to major metropolitan areas in NSW, VIC, and QLD generally arrive within 1 to 2 business days after dispatch.

Do you supply a Certificate of Analysis (COA)?

Yes, we provide batch-specific COAs displaying HPLC purity and mass spectrometry profiles upon request for complete laboratory verification.

Compliance & Legal Notice: FOXO4 D-Retro-Inverso (FOXO4-DRI) peptide is supplied strictly for non-clinical laboratory research, analytical testing, and cellular senescence studies. The Therapeutic Goods Administration (TGA) has not evaluated or approved this compound for human therapeutic, diagnostic, or cosmetic use. Buyers must handle all chemicals in accordance with local Australian laws.

MG

10mg*10vials

Cat. No

F410

Reviews

There are no reviews yet.

Be the first to review “Buy FOXO4-DRI Online in Australia”

Your email address will not be published. Required fields are marked *